(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCB

CP002031.CBCB        Location/Qualifiers
FT   CDS             complement(604374..605030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcB"
FT                   /locus_tag="KN400_0571"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome b subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83434"
FT                   /protein_id="ADI83434.1"
FT                   /translation="MSAHNEHAEHKEFIYLTPMPIRIWHWINALGIVTLCLTGIQIRFP
FT                   EYVNIFGTYKAAIRLHNTAGITVSIFYAIWFAYYLIVKGNLFKLYVPNTYDIKMGIFRQ
FT                   VLYYFYYFFKGGQSPHHATPDDKFNPMQKVAYMGLMLALMPLVIVTGILILNVAPLREL
FT                   ILLMGGLKILVSAHFLIACCFFAFLFVHVYLATMGHTPLAHFKPMWDGWEEVEHH"
     MSAHNEHAEH KEFIYLTPMP IRIWHWINAL GIVTLCLTGI QIRFPEYVNI FGTYKAAIRL        60
     HNTAGITVSI FYAIWFAYYL IVKGNLFKLY VPNTYDIKMG IFRQVLYYFY YFFKGGQSPH       120
     HATPDDKFNP MQKVAYMGLM LALMPLVIVT GILILNVAPL RELILLMGGL KILVSAHFLI       180
     ACCFFAFLFV HVYLATMGHT PLAHFKPMWD GWEEVEHH                               218
//

If you have problems or comments...

PBIL Back to PBIL home page