(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCD

CP002031.CBCD        Location/Qualifiers
FT   CDS             complement(602229..603080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcD"
FT                   /locus_tag="KN400_0569"
FT                   /product="menaquinol oxidoreductase complex Cbc5,
FT                   cytochrome c subunit, putative, HAMP domain-containing, 2
FT                   heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83432"
FT                   /protein_id="ADI83432.1"
FT                   /translation="MPRSFAAKAIVPPAIAVTGFVIVCCILLYSVIKTDMLNDAIQHET
FT                   NLADTIVKSARYAMLKDDRETLRNIIDNVGQQKGVEHARIFNKKGVIMFSAHPEDIGKL
FT                   LDKKEAGCVACHSGPVPLTSMGRMDQARRFINEKGRHVIAITVPVYNEPECFNAACHVH
FT                   SPSQKVLGTLDIGLSEAPLQKTLNVMQGRMIVFCLMVLLLTVGGVSALLRRNVLLPVRE
FT                   LADYVSAVKRGDLSRKAPAYRDEVGELARAYQELAHQLKERRESPDEATQDGPAGDRGN
FT                   RS"
     MPRSFAAKAI VPPAIAVTGF VIVCCILLYS VIKTDMLNDA IQHETNLADT IVKSARYAML        60
     KDDRETLRNI IDNVGQQKGV EHARIFNKKG VIMFSAHPED IGKLLDKKEA GCVACHSGPV       120
     PLTSMGRMDQ ARRFINEKGR HVIAITVPVY NEPECFNAAC HVHSPSQKVL GTLDIGLSEA       180
     PLQKTLNVMQ GRMIVFCLMV LLLTVGGVSA LLRRNVLLPV RELADYVSAV KRGDLSRKAP       240
     AYRDEVGELA RAYQELAHQL KERRESPDEA TQDGPAGDRG NRS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page