(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCS

CP002031.CBCS        Location/Qualifiers
FT   CDS             52195..52677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcS"
FT                   /locus_tag="KN400_0044"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   cytochrome c subunit, putative, 4 heme-binding sites"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82907"
FT                   /protein_id="ADI82907.1"
FT                   /translation="MKSHVWRPLYVALSVAGALLLARSFLVPNDFGVHEQGYMYGWHRK
FT                   GNENEWKQVPVKYRTKAYCVGCHAAKVASIDRSPHGVIPCENCHGPALGHPKDPPTLTI
FT                   DHSRRLCLRCHAKLVTPSSGRSQIRGIDPDTHNPQAECRLCHDPHHPNLEELKRYE"
     MKSHVWRPLY VALSVAGALL LARSFLVPND FGVHEQGYMY GWHRKGNENE WKQVPVKYRT        60
     KAYCVGCHAA KVASIDRSPH GVIPCENCHG PALGHPKDPP TLTIDHSRRL CLRCHAKLVT       120
     PSSGRSQIRG IDPDTHNPQA ECRLCHDPHH PNLEELKRYE                             160
//

If you have problems or comments...

PBIL Back to PBIL home page