(data stored in SCRATCH3701 zone)

EMBL: CP002031.CBCU

CP002031.CBCU        Location/Qualifiers
FT   CDS             53446..54699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbcU"
FT                   /locus_tag="KN400_0046"
FT                   /product="menaquinol oxidoreductase complex Cbc4,
FT                   cytochrome b subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82909"
FT                   /protein_id="ADI82909.1"
FT                   /translation="MVHGEAWTVKELFVYPNEYIYWTIQIVMYPFLTGLVAGAFVLSSL
FT                   YHVFGVKQLKDIARFSLVFSFALLPCAPLPLLLHLQQPLRNHHVLMTPHFTSAIAAFGI
FT                   VFLTYGMIVASELWFVYRGYFAATARQLKEQREHTRAETIKMRLYSVLVLGAWDVSHRA
FT                   LEQDERAVKILAAVGIPVACFLHGYAGFIFGSVKANALWMTPLMPVIFICSAVVSGIAL
FT                   CILTYIVTMELRKFVAAWRRRDNPGLPAPAEHGGEEANVVRMTSRYLIMFLILAITLEL
FT                   LDLIFRGYTAVKSWDILRSVIYGKDFVAIFVLQYGLGNLVPFILFLLPGLTVRRAVAGT
FT                   LLVLFGVFMMRWNVVIGGQAFSASFAGFMHYHLPIIPHDLETFKEGLFGALAVGSVPFV
FT                   LFWFLSRIFPVFGSDERH"
     MVHGEAWTVK ELFVYPNEYI YWTIQIVMYP FLTGLVAGAF VLSSLYHVFG VKQLKDIARF        60
     SLVFSFALLP CAPLPLLLHL QQPLRNHHVL MTPHFTSAIA AFGIVFLTYG MIVASELWFV       120
     YRGYFAATAR QLKEQREHTR AETIKMRLYS VLVLGAWDVS HRALEQDERA VKILAAVGIP       180
     VACFLHGYAG FIFGSVKANA LWMTPLMPVI FICSAVVSGI ALCILTYIVT MELRKFVAAW       240
     RRRDNPGLPA PAEHGGEEAN VVRMTSRYLI MFLILAITLE LLDLIFRGYT AVKSWDILRS       300
     VIYGKDFVAI FVLQYGLGNL VPFILFLLPG LTVRRAVAGT LLVLFGVFMM RWNVVIGGQA       360
     FSASFAGFMH YHLPIIPHDL ETFKEGLFGA LAVGSVPFVL FWFLSRIFPV FGSDERH          417
//

If you have problems or comments...

PBIL Back to PBIL home page