(data stored in SCRATCH3701 zone)

EMBL: CP002031.CHEA64H

CP002031.CHEA64H     Location/Qualifiers
FT   CDS             complement(291836..293668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA64H"
FT                   /locus_tag="KN400_0267"
FT                   /product="sensor histidine kinase CheA associated with MCPs
FT                   of classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83130"
FT                   /protein_id="ADI83130.1"
FT                   /translation="MAIECEDQELLEGFLTETTELLEKLDDDLVALEKAPSDADLLNGI
FT                   FRSIHTVKGASSFLGFELLVKVTHKTEDVLNRLRRGELIVTPEIMDVILEAVDLVKVLV
FT                   ADIKGGDIVDREIDGTISKLIPLLSENAKEATVLKAPAAQPETSAPAEQSAEETASASE
FT                   QSADASAPTETAPPPPPEKAASAPAVRPQNAPAPAKDDKKADDLADNSTVRVDVKRLDD
FT                   LMNQVGELVLERNRMMQLNTDFQGDSGDSSFGEEFAKLSKRISFVTSELQMQVLKMRMI
FT                   PVEKVFKKFPRIVRNLARDLGKEVDLTVLGEETELDRSVVDEIGDPLIHLIRNAMDHGL
FT                   ETPDERVAAGKPRKGTLILSAAHEGNQIVISIKDDGRGVDTDKVARKAKEKGLVTDEQL
FT                   AAMGQRELLDLIFLPGFSTKEKATDLSGRGVGMDVVRTNIKKLNGIIDIRSELGRGSEF
FT                   ILKLPLTLAIIQSLLVEVEDETYSLPLAAVLETLRVDEKEFHTIGGQEVLKLRDSVLPL
FT                   MRLQRIFNIAPGERNRSSCYVVVVGVAEKRVGLVVSRLLGQQEVAIKSLGKYLANLPGI
FT                   AGSTILGDGRVTLIIDPAGLIENSDGSGGGRVAA"
     MAIECEDQEL LEGFLTETTE LLEKLDDDLV ALEKAPSDAD LLNGIFRSIH TVKGASSFLG        60
     FELLVKVTHK TEDVLNRLRR GELIVTPEIM DVILEAVDLV KVLVADIKGG DIVDREIDGT       120
     ISKLIPLLSE NAKEATVLKA PAAQPETSAP AEQSAEETAS ASEQSADASA PTETAPPPPP       180
     EKAASAPAVR PQNAPAPAKD DKKADDLADN STVRVDVKRL DDLMNQVGEL VLERNRMMQL       240
     NTDFQGDSGD SSFGEEFAKL SKRISFVTSE LQMQVLKMRM IPVEKVFKKF PRIVRNLARD       300
     LGKEVDLTVL GEETELDRSV VDEIGDPLIH LIRNAMDHGL ETPDERVAAG KPRKGTLILS       360
     AAHEGNQIVI SIKDDGRGVD TDKVARKAKE KGLVTDEQLA AMGQRELLDL IFLPGFSTKE       420
     KATDLSGRGV GMDVVRTNIK KLNGIIDIRS ELGRGSEFIL KLPLTLAIIQ SLLVEVEDET       480
     YSLPLAAVLE TLRVDEKEFH TIGGQEVLKL RDSVLPLMRL QRIFNIAPGE RNRSSCYVVV       540
     VGVAEKRVGL VVSRLLGQQE VAIKSLGKYL ANLPGIAGST ILGDGRVTLI IDPAGLIENS       600
     DGSGGGRVAA                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page