(data stored in SCRATCH3701 zone)

EMBL: CP002031.CHEW64H-1

CP002031.CHEW64H-1   Location/Qualifiers
FT   CDS             complement(293717..294211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW64H-1"
FT                   /locus_tag="KN400_0268"
FT                   /product="scaffold protein CheW associated with MCPs of
FT                   classes 40H and 40+24H"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83131"
FT                   /protein_id="ADI83131.1"
FT                   /translation="MQNALQTRVDETRNELIQLVSFKLEEEEYGVNVLKVREIIRMPSI
FT                   TRVPNTPHYVEGVINLRGKVIPIISMRKRFGLPEGENSSQTRIMVMDMEGELMGFVVDA
FT                   VSEVIRISESEIQPPPAVVNSAVEQECLSGVINQTERLLFFLDLEKLITQDERRLFSGM
FT                   I"
     MQNALQTRVD ETRNELIQLV SFKLEEEEYG VNVLKVREII RMPSITRVPN TPHYVEGVIN        60
     LRGKVIPIIS MRKRFGLPEG ENSSQTRIMV MDMEGELMGF VVDAVSEVIR ISESEIQPPP       120
     AVVNSAVEQE CLSGVINQTE RLLFFLDLEK LITQDERRLF SGMI                        164
//

If you have problems or comments...

PBIL Back to PBIL home page