(data stored in SCRATCH3701 zone)

EMBL: CP002031.DEF-1

CP002031.DEF-1       Location/Qualifiers
FT   CDS             112516..113019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="KN400_0105"
FT                   /product="polypeptide formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82968"
FT                   /protein_id="ADI82968.1"
FT                   /translation="MVRTILTYPDPVLKKKAVPVTIINDATRELVRDMAETMYDAQGVG
FT                   LAAPQIGVSQRVIVIDVSQRDERPELIVCINPVIIHGEGESYEEEGCLSVPKYSANVHR
FT                   HERVVVKSLNLEGEEVVHRAEGLLAIAFQHEIDHLDGVLFVDHLSALKKEMFKKKYRRM
FT                   TEEE"
     MVRTILTYPD PVLKKKAVPV TIINDATREL VRDMAETMYD AQGVGLAAPQ IGVSQRVIVI        60
     DVSQRDERPE LIVCINPVII HGEGESYEEE GCLSVPKYSA NVHRHERVVV KSLNLEGEEV       120
     VHRAEGLLAI AFQHEIDHLD GVLFVDHLSA LKKEMFKKKY RRMTEEE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page