(data stored in SCRATCH3701 zone)

EMBL: CP002031.DMEF

CP002031.DMEF        Location/Qualifiers
FT   CDS             complement(505019..506014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmeF"
FT                   /locus_tag="KN400_0474"
FT                   /product="cobalt/zinc/iron/cadmium/nickel efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83337"
FT                   /protein_id="ADI83337.1"
FT                   /translation="MHADSHLDRSITGRLKYAIALTALTLVAEIVGGIWTNSLALLSDA
FT                   AHVFLDLFALVLSLAAIKLASYPASDTKTFGWHRAEVFASFINGATVFLMALGIFYEAV
FT                   GRLMNPEAVKSLPMLLIATLGLVMNLISATALHGHSHDDLNVRSAFLHVVGDAAASVGV
FT                   IVGGLIMYFTGWYVLDALISIGIGCVIFAGSWRVLREAAHILLEGVPRGMSTQQVANEM
FT                   AGVEGVNAVHQMNIWTICSHILALSAHVDVKPEYKGQQAEVLRQIEQLLFERYHITHTT
FT                   LQAECTRCVDGPVIKDLRHRPRHGQSHDDHHHAHAHCTHGPHGHHHGHSH"
     MHADSHLDRS ITGRLKYAIA LTALTLVAEI VGGIWTNSLA LLSDAAHVFL DLFALVLSLA        60
     AIKLASYPAS DTKTFGWHRA EVFASFINGA TVFLMALGIF YEAVGRLMNP EAVKSLPMLL       120
     IATLGLVMNL ISATALHGHS HDDLNVRSAF LHVVGDAAAS VGVIVGGLIM YFTGWYVLDA       180
     LISIGIGCVI FAGSWRVLRE AAHILLEGVP RGMSTQQVAN EMAGVEGVNA VHQMNIWTIC       240
     SHILALSAHV DVKPEYKGQQ AEVLRQIEQL LFERYHITHT TLQAECTRCV DGPVIKDLRH       300
     RPRHGQSHDD HHHAHAHCTH GPHGHHHGHS H                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page