(data stored in SCRATCH3701 zone)

EMBL: CP002031.DNAJ

CP002031.DNAJ        Location/Qualifiers
FT   CDS             44507..45628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="KN400_0035"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82898"
FT                   /protein_id="ADI82898.1"
FT                   /translation="MAADKRDYYEVLGVHKNASDTEIKKAFRKLAIQYHPDKNPDDKEA
FT                   EEKFKEITEAYEVLSDPQKRAQYDQFGHAGVGAGGFSGGGFGGFGAGTPFGDIFGDIFG
FT                   DIFGGRPRGSRGRRGDDLQYNMELSFEEAAFGAEKEIQVPYGKRCGDCGGSGAKPGTEP
FT                   KVCPTCRGAGQVRFQQGFFSVSKTCNHCNGEGRVVENPCTSCRGSGMIRDTKTLSVKVP
FT                   AGVETGTRLKLSGEGGQGIKGGGNGDLYVAIAVREHPIFTREDNDVLCEIPVSFVQAAL
FT                   GCEIEVPTLDGKVSMKIPEGTQSGRIFRLRGKGVPQLQGYGRGDQLVIIKVETPSNLNK
FT                   RQRELLEEFARISGEDVHPMKKSFFDKVMDFIS"
     MAADKRDYYE VLGVHKNASD TEIKKAFRKL AIQYHPDKNP DDKEAEEKFK EITEAYEVLS        60
     DPQKRAQYDQ FGHAGVGAGG FSGGGFGGFG AGTPFGDIFG DIFGDIFGGR PRGSRGRRGD       120
     DLQYNMELSF EEAAFGAEKE IQVPYGKRCG DCGGSGAKPG TEPKVCPTCR GAGQVRFQQG       180
     FFSVSKTCNH CNGEGRVVEN PCTSCRGSGM IRDTKTLSVK VPAGVETGTR LKLSGEGGQG       240
     IKGGGNGDLY VAIAVREHPI FTREDNDVLC EIPVSFVQAA LGCEIEVPTL DGKVSMKIPE       300
     GTQSGRIFRL RGKGVPQLQG YGRGDQLVII KVETPSNLNK RQRELLEEFA RISGEDVHPM       360
     KKSFFDKVMD FIS                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page