(data stored in SCRATCH3701 zone)

EMBL: CP002031.EHRA-1

CP002031.EHRA-1      Location/Qualifiers
FT   CDS             762718..764703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrA-1"
FT                   /locus_tag="KN400_0717"
FT                   /product="Ech-hydrogenase-related complex, NuoL-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83580"
FT                   /protein_id="ADI83580.1"
FT                   /translation="MESALEGADPASQILAAIVLVALSGVPGVLARRFVPGQILAAVMA
FT                   VAASLLGLTGTIRTLLEHRTTAFSLAWTLPFGPADLAVDPLSALFLIPVFLVFGCGSLY
FT                   ALGYWPAAANRSTEPALTFFYGILAAAMAGLVVARNGVLFLMAWEAMALSAWFLLATEH
FT                   RDPAVRQAGIVYLAATHAGTAALFVLFCVLRGVTGSFVFPAPHSLDPALVPATVLFLAA
FT                   LAGFGAKAGIMPLHIWLPAAHASAPSHVSALMSGVMLKMGLYGLVRTISFFAPVPLWWG
FT                   GLILVLGAVSALAGIVLAASQRDLKRLLACSSIENIGIIALGIGTALVGEATGNVPLYT
FT                   LGMTGALLHLLNHSLFKPLLFFGAGAVIHATGTREMDRMGGLARLMPRSALFFLVGSVA
FT                   ICGLPPLNGFVGEFLLYAGFFGEAVADPVPLLALSAPLLAVVGGIATVSFVKLYGVIFL
FT                   GVPRCGAHHHSHLPDWRMGAPMGLLALLCLAAGIAPGPVLSLVEPAVGAFGMVPPAPLE
FT                   TLVPLGWLTLGAGMLGAAVILSGLLLMFRLKRTPAARGTTWGCGYPAPSPRMQYTGVSF
FT                   ADSLVRQFEGVVAPRREGPAVAGFFPAPVLFRFVPTETILERVIMPLFRVAGFSFAFLR
FT                   RLQHGRLHLYMLYILTTLFLLMVWAH"
     MESALEGADP ASQILAAIVL VALSGVPGVL ARRFVPGQIL AAVMAVAASL LGLTGTIRTL        60
     LEHRTTAFSL AWTLPFGPAD LAVDPLSALF LIPVFLVFGC GSLYALGYWP AAANRSTEPA       120
     LTFFYGILAA AMAGLVVARN GVLFLMAWEA MALSAWFLLA TEHRDPAVRQ AGIVYLAATH       180
     AGTAALFVLF CVLRGVTGSF VFPAPHSLDP ALVPATVLFL AALAGFGAKA GIMPLHIWLP       240
     AAHASAPSHV SALMSGVMLK MGLYGLVRTI SFFAPVPLWW GGLILVLGAV SALAGIVLAA       300
     SQRDLKRLLA CSSIENIGII ALGIGTALVG EATGNVPLYT LGMTGALLHL LNHSLFKPLL       360
     FFGAGAVIHA TGTREMDRMG GLARLMPRSA LFFLVGSVAI CGLPPLNGFV GEFLLYAGFF       420
     GEAVADPVPL LALSAPLLAV VGGIATVSFV KLYGVIFLGV PRCGAHHHSH LPDWRMGAPM       480
     GLLALLCLAA GIAPGPVLSL VEPAVGAFGM VPPAPLETLV PLGWLTLGAG MLGAAVILSG       540
     LLLMFRLKRT PAARGTTWGC GYPAPSPRMQ YTGVSFADSL VRQFEGVVAP RREGPAVAGF       600
     FPAPVLFRFV PTETILERVI MPLFRVAGFS FAFLRRLQHG RLHLYMLYIL TTLFLLMVWA       660
     H                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page