(data stored in SCRATCH3701 zone)

EMBL: CP002031.EHRA-2

CP002031.EHRA-2      Location/Qualifiers
FT   CDS             complement(759218..761224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ehrA-2"
FT                   /locus_tag="KN400_0713"
FT                   /product="Ech-hydrogenase-related complex, NuoL-like
FT                   integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83576"
FT                   /protein_id="ADI83576.1"
FT                   /translation="MTDGGGMVSPGMLLLCASALAALSGVPLLVRSLSPAAGQKAATVL
FT                   MLLATVIGLGSAVATLVTGRTETFLLSWGLPFGPAEMAVDPLSAFFALPILLVAACCAV
FT                   YALGYWPARDNPRTVRSLTFFFGLLVAALIGVIVARNGVLFLVAWEIMAVSAWFVLTAD
FT                   HAKPEVRDAGTLYLITTHIGTLALFALFSLLKGTAGSYLFPAPASLAAGGGIGAGIFLT
FT                   ALLGFGIKAGLMPLHVWLPSAHANAPSHISAIMSGVILKLGIYGIVRTVSFFAQIPLWW
FT                   GIVLLVAGMASGIAGVAFALGQHDLKRLLAYHSIENIGIIAMGIGVALVGAATGVPSLA
FT                   LLGMAGALLHVLNHATFKALLFLGAGSVIHAVGTRKIDRMGGIARVMPRTALLFLTGAV
FT                   AICGLPPLNGFVSEFLIYLGVFREAVHGTGAAAAVTSLAGPALALVGGLAVACFVKVFG
FT                   VVFLGLPRSEEAARAHEAGRPMLAPMAVLGAVCVVVGLAPAAVGALLDAAVRSWRPELA
FT                   LTAPALADLAPLGWLMAVAAGTLATVAVLALLYARRLAAVPRGASPTWGCGYLAPTPRM
FT                   QYTASSFAEMLVRLFGGILRPHGTQPGIRSCAPAPSELHTHVPETVLEHLYLPFITWAN
FT                   GKLAPLRRLQHGQLHLYILYTLITLVTLLLFGM"
     MTDGGGMVSP GMLLLCASAL AALSGVPLLV RSLSPAAGQK AATVLMLLAT VIGLGSAVAT        60
     LVTGRTETFL LSWGLPFGPA EMAVDPLSAF FALPILLVAA CCAVYALGYW PARDNPRTVR       120
     SLTFFFGLLV AALIGVIVAR NGVLFLVAWE IMAVSAWFVL TADHAKPEVR DAGTLYLITT       180
     HIGTLALFAL FSLLKGTAGS YLFPAPASLA AGGGIGAGIF LTALLGFGIK AGLMPLHVWL       240
     PSAHANAPSH ISAIMSGVIL KLGIYGIVRT VSFFAQIPLW WGIVLLVAGM ASGIAGVAFA       300
     LGQHDLKRLL AYHSIENIGI IAMGIGVALV GAATGVPSLA LLGMAGALLH VLNHATFKAL       360
     LFLGAGSVIH AVGTRKIDRM GGIARVMPRT ALLFLTGAVA ICGLPPLNGF VSEFLIYLGV       420
     FREAVHGTGA AAAVTSLAGP ALALVGGLAV ACFVKVFGVV FLGLPRSEEA ARAHEAGRPM       480
     LAPMAVLGAV CVVVGLAPAA VGALLDAAVR SWRPELALTA PALADLAPLG WLMAVAAGTL       540
     ATVAVLALLY ARRLAAVPRG ASPTWGCGYL APTPRMQYTA SSFAEMLVRL FGGILRPHGT       600
     QPGIRSCAPA PSELHTHVPE TVLEHLYLPF ITWANGKLAP LRRLQHGQLH LYILYTLITL       660
     VTLLLFGM                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page