(data stored in SCRATCH3701 zone)

EMBL: CP002031.ELBB

CP002031.ELBB        Location/Qualifiers
FT   CDS             complement(56321..56974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="KN400_0049"
FT                   /product="isoprenoid biosynthesis amidotransferase-like
FT                   protein ElbB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82912"
FT                   /protein_id="ADI82912.1"
FT                   /translation="MKKIGVVLSGCGVYDGSEIHEAVLTLLAIDRNGAEAVCMAPSMEF
FT                   REVNHLTSQETGATRNALVEAARIARGKIRDVKDVSAVELDAVIFPGGYGAAKNLCTFA
FT                   EKGAAATINPEVARLIREMAVAKKPIGAICIAPALIAATLGRDYKPKVTIGTDAGTAAA
FT                   ITETGSEHVSCPVAEFVVDRENKIVTTPAYMLANRISEAAEGIEKAVKAVVEMA"
     MKKIGVVLSG CGVYDGSEIH EAVLTLLAID RNGAEAVCMA PSMEFREVNH LTSQETGATR        60
     NALVEAARIA RGKIRDVKDV SAVELDAVIF PGGYGAAKNL CTFAEKGAAA TINPEVARLI       120
     REMAVAKKPI GAICIAPALI AATLGRDYKP KVTIGTDAGT AAAITETGSE HVSCPVAEFV       180
     VDRENKIVTT PAYMLANRIS EAAEGIEKAV KAVVEMA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page