(data stored in SCRATCH3701 zone)

EMBL: CP002031.FABD-1

CP002031.FABD-1      Location/Qualifiers
FT   CDS             complement(215925..216767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD-1"
FT                   /locus_tag="KN400_0214"
FT                   /product="malonyl-CoA--acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83077"
FT                   /protein_id="ADI83077.1"
FT                   /translation="MICFMFPGQPLAPPVEFPEDADFEAIALLTRQRASFDLHTFSWTG
FT                   EPSSDTVALQAYGVAMGLYRTRRLRAEGIAPRLIAEHSMGIYPALAAAGALDEGDALEL
FT                   AVRLGRTMAAMGRQRTYALGCMVGLTLEPLLVIAENNGVYLANHNTSRHFLLAGERGAM
FT                   EDACAEALARGAFSARLFPCDAPLHTPLMAEVAEELAAVAGDYRYREPSVPLVDHIDQD
FT                   FLAAADLPVFMVRDLMEPVRWERTYRALRAAGVDRLYEVGAGDSLRKYNRWIESERGR"
     MICFMFPGQP LAPPVEFPED ADFEAIALLT RQRASFDLHT FSWTGEPSSD TVALQAYGVA        60
     MGLYRTRRLR AEGIAPRLIA EHSMGIYPAL AAAGALDEGD ALELAVRLGR TMAAMGRQRT       120
     YALGCMVGLT LEPLLVIAEN NGVYLANHNT SRHFLLAGER GAMEDACAEA LARGAFSARL       180
     FPCDAPLHTP LMAEVAEELA AVAGDYRYRE PSVPLVDHID QDFLAAADLP VFMVRDLMEP       240
     VRWERTYRAL RAAGVDRLYE VGAGDSLRKY NRWIESERGR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page