(data stored in SCRATCH3701 zone)

EMBL: CP002031.FABG-1

CP002031.FABG-1      Location/Qualifiers
FT   CDS             complement(462086..462826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG-1"
FT                   /locus_tag="KN400_0435"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83298"
FT                   /protein_id="ADI83298.1"
FT                   /translation="MEFKDSIVVVTGGTRGIGRAISLHFARQGALVTAAYRADDEAARA
FT                   LEAEAAGLPGSIAVIRADVGTAEGAMAVIDAASGESGTLHVLVNNAGIIRDGYLAMMAE
FT                   DDWDAVMRANLSPLFHCCKWGVRKMLARRRGAIINLSSVSAFAGTAGQTNYAATKGAAV
FT                   SFTKSLAREVGPLGIRVNAVAPGLIETEMIAGMKREMVDRIVGSSILGRTGRPEEVAEA
FT                   VAFLASDRASYITGQCLVVDGGIL"
     MEFKDSIVVV TGGTRGIGRA ISLHFARQGA LVTAAYRADD EAARALEAEA AGLPGSIAVI        60
     RADVGTAEGA MAVIDAASGE SGTLHVLVNN AGIIRDGYLA MMAEDDWDAV MRANLSPLFH       120
     CCKWGVRKML ARRRGAIINL SSVSAFAGTA GQTNYAATKG AAVSFTKSLA REVGPLGIRV       180
     NAVAPGLIET EMIAGMKREM VDRIVGSSIL GRTGRPEEVA EAVAFLASDR ASYITGQCLV       240
     VDGGIL                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page