(data stored in SCRATCH3701 zone)

EMBL: CP002031.FABZ-1

CP002031.FABZ-1      Location/Qualifiers
FT   CDS             complement(459327..459716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ-1"
FT                   /locus_tag="KN400_0432"
FT                   /product="(3R)-hydroxyacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83295"
FT                   /protein_id="ADI83295.1"
FT                   /translation="MHSPAPWDFLPHRYPFLVLDRIIAKEPGRSATALMRTTAAGTRGW
FT                   SSLLLLEAMAQLGGIAAADDTNGGGILAAVDHADFHGTVEAGDTLTVSVTVVKSFGPLH
FT                   LIAGEVTADGRPAASATITLKVGNL"
     MHSPAPWDFL PHRYPFLVLD RIIAKEPGRS ATALMRTTAA GTRGWSSLLL LEAMAQLGGI        60
     AAADDTNGGG ILAAVDHADF HGTVEAGDTL TVSVTVVKSF GPLHLIAGEV TADGRPAASA       120
     TITLKVGNL                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page