(data stored in SCRATCH3701 zone)

EMBL: CP002031.FDNI

CP002031.FDNI        Location/Qualifiers
FT   CDS             814968..816173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdnI"
FT                   /locus_tag="KN400_0759"
FT                   /product="periplasmically oriented, membrane-bound formate
FT                   dehydrogenase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83622"
FT                   /protein_id="ADI83622.1"
FT                   /translation="MTAARIVINEIKGYHRFIKFLMVLVGAAAVASAVRFIFGLGATTN
FT                   LNDLYPWGLWISFDVVTAVPLAAGAFTIGIVAHVFHIKKLEPLVRPAIVTGFLGYSLVC
FT                   VGLLLDLGQPQRGPYVLFNWNVHSPMFEVSMCVMAYTTVLFLEFLHPVSERFGWHIPLR
FT                   LLRTLELPFAILAAMISTLHQSTLGTFFLIAVDKLHNLWYNPLLPLQFWLSAIFTGLSI
FT                   VIFEASLVHKYMGQPDESDLLATLTKIIPWIMGVYIAVKAYALAFLSHGPLFDRPVLTA
FT                   LFSVEVIVGLLIPFAMFLTKRIRTDKQMQLRAASLVIVGLILNRFNVSMFAMHQPGQPV
FT                   YFPNFIESVVTIGIIAAHILFFVLIAKYFPIFEHHPEATDYTIPDRFRKIEKHGHGTAS
FT                   EA"
     MTAARIVINE IKGYHRFIKF LMVLVGAAAV ASAVRFIFGL GATTNLNDLY PWGLWISFDV        60
     VTAVPLAAGA FTIGIVAHVF HIKKLEPLVR PAIVTGFLGY SLVCVGLLLD LGQPQRGPYV       120
     LFNWNVHSPM FEVSMCVMAY TTVLFLEFLH PVSERFGWHI PLRLLRTLEL PFAILAAMIS       180
     TLHQSTLGTF FLIAVDKLHN LWYNPLLPLQ FWLSAIFTGL SIVIFEASLV HKYMGQPDES       240
     DLLATLTKII PWIMGVYIAV KAYALAFLSH GPLFDRPVLT ALFSVEVIVG LLIPFAMFLT       300
     KRIRTDKQMQ LRAASLVIVG LILNRFNVSM FAMHQPGQPV YFPNFIESVV TIGIIAAHIL       360
     FFVLIAKYFP IFEHHPEATD YTIPDRFRKI EKHGHGTASE A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page