(data stored in SCRATCH3701 zone)

EMBL: CP002031.FGRK

CP002031.FGRK        Location/Qualifiers
FT   CDS             15618..17117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fgrK"
FT                   /locus_tag="KN400_0010"
FT                   /product="sensor histidine kinase of FgrL, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82873"
FT                   /protein_id="ADI82873.1"
FT                   /translation="MGNEHRRAPHQIAAIYLVVGMFWILFSDRILTGIAPEAAQLTRLQ
FT                   TAKGWFYVAATAGLLYWLVRRYALSAERAEDELRARNEELCMVEEELRQQLDEYEKSQF
FT                   ELHETNQALRASEERYRVLFASNPHPMWVCDLDTKAFLEVNDAAVTHYGYSREEFLAMT
FT                   MRDIGPAAGSPAPGEGAAQARECPCLKPTGIQCHRKKDGTLIAVEITSHTLDFGGRPAE
FT                   VVLASNVTERIKADEEVRRLNAELEERVEARTQELQRANRELESFSYSVSHDLRAPLRH
FT                   IDGFSRMLVEDYGERIDAAGKGYIQRIRSAAQRMGCLIDDLLQLANVSRSELEKRQVNL
FT                   SALAQVIGLGLKQIEGREDVTLRITEGVMAFGDPRLLRVVLENLLSNAWKYTGKRADAV
FT                   IEFAVEEQGSGRPVYLVRDNGVGFDMTFAGKLFTPFQRLHSADEFEGTGIGLATVRRIV
FT                   ERHGGTVWVEAAPDHGATFYFTLGEEEHLARNSDKEDGTTQ"
     MGNEHRRAPH QIAAIYLVVG MFWILFSDRI LTGIAPEAAQ LTRLQTAKGW FYVAATAGLL        60
     YWLVRRYALS AERAEDELRA RNEELCMVEE ELRQQLDEYE KSQFELHETN QALRASEERY       120
     RVLFASNPHP MWVCDLDTKA FLEVNDAAVT HYGYSREEFL AMTMRDIGPA AGSPAPGEGA       180
     AQARECPCLK PTGIQCHRKK DGTLIAVEIT SHTLDFGGRP AEVVLASNVT ERIKADEEVR       240
     RLNAELEERV EARTQELQRA NRELESFSYS VSHDLRAPLR HIDGFSRMLV EDYGERIDAA       300
     GKGYIQRIRS AAQRMGCLID DLLQLANVSR SELEKRQVNL SALAQVIGLG LKQIEGREDV       360
     TLRITEGVMA FGDPRLLRVV LENLLSNAWK YTGKRADAVI EFAVEEQGSG RPVYLVRDNG       420
     VGFDMTFAGK LFTPFQRLHS ADEFEGTGIG LATVRRIVER HGGTVWVEAA PDHGATFYFT       480
     LGEEEHLARN SDKEDGTTQ                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page