(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLGC

CP002031.FLGC        Location/Qualifiers
FT   CDS             405671..406111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="KN400_0376"
FT                   /product="flagellar basal body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83239"
FT                   /protein_id="ADI83239.1"
FT                   /translation="MDFFSAMQVSSSALSAERTRMNLISANLANANSTRTAEGGPYKRK
FT                   DAVFAATQVGEGFRSALDRMRKNAPQGVQVTGIVEDPNPPRLQYDPSHPDADAKGYVAL
FT                   PNVNVVEEMADMIAATRAYEANVTAMQAAKNMALKTLEIGSR"
     MDFFSAMQVS SSALSAERTR MNLISANLAN ANSTRTAEGG PYKRKDAVFA ATQVGEGFRS        60
     ALDRMRKNAP QGVQVTGIVE DPNPPRLQYD PSHPDADAKG YVALPNVNVV EEMADMIAAT       120
     RAYEANVTAM QAAKNMALKT LEIGSR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page