(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLGE

CP002031.FLGE        Location/Qualifiers
FT   CDS             415232..416491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="KN400_0387"
FT                   /product="flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83250"
FT                   /protein_id="ADI83250.1"
FT                   /translation="MSVTSALYTGISGLNANGEAMSVIGNNISNVNTIGFKQGRMLFSD
FT                   VLSSTISGGSQIGRGVQIQTVENQFTQGSFESTESGTDLAIQGDSFFVVQNTSGRYYTR
FT                   AGAFSFNKDKTLVNPEGYQVMGYGIIPSSGLSDGVLKPIDLTNFATTPPKQTSTVKFVV
FT                   NLDSTQTTPTLAWDPANPVATSNYSTSLSVYDSQGNAHTATVYFRKTADNAWDWHVILP
FT                   DAAAGTPGSTTTPIDGTLTFDATGALTAQTPLAGAAQNITFAGGVTAPQPIFFDLGVGA
FT                   TTQYASSSVVSSQTQDGYYQGTLTKVTIDDKGYVNGVYSNGQLQKLYQVALAKFSSTAG
FT                   LSKAGGTLFEETLESGQPLFSDASTPGVGKILANSLEQSNVDMAAQFVKMITTQRGYSA
FT                   NSKTITTADEMLQEVLSLKR"
     MSVTSALYTG ISGLNANGEA MSVIGNNISN VNTIGFKQGR MLFSDVLSST ISGGSQIGRG        60
     VQIQTVENQF TQGSFESTES GTDLAIQGDS FFVVQNTSGR YYTRAGAFSF NKDKTLVNPE       120
     GYQVMGYGII PSSGLSDGVL KPIDLTNFAT TPPKQTSTVK FVVNLDSTQT TPTLAWDPAN       180
     PVATSNYSTS LSVYDSQGNA HTATVYFRKT ADNAWDWHVI LPDAAAGTPG STTTPIDGTL       240
     TFDATGALTA QTPLAGAAQN ITFAGGVTAP QPIFFDLGVG ATTQYASSSV VSSQTQDGYY       300
     QGTLTKVTID DKGYVNGVYS NGQLQKLYQV ALAKFSSTAG LSKAGGTLFE ETLESGQPLF       360
     SDASTPGVGK ILANSLEQSN VDMAAQFVKM ITTQRGYSAN SKTITTADEM LQEVLSLKR        419
//

If you have problems or comments...

PBIL Back to PBIL home page