(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIF

CP002031.FLIF        Location/Qualifiers
FT   CDS             406544..408127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="KN400_0378"
FT                   /product="flagellar M-ring mounting plate protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83241"
FT                   /protein_id="ADI83241.1"
FT                   /translation="MPEALNKLIQPFMALPPAKRWVVGGVVGLSVIAFTILILVANRTD
FT                   YRPLFTNLTSEDAGEIVTKLKEQKVPYRIAADGKAILVPSDKVYDLRLSLASDGLPQGG
FT                   GVGFEIFDRKNFGMTDFVQKLNYQRALQGELSRTISQISGVEQARVHLVIPEKSLFKED
FT                   EKPATASVVLKVKGQRQLRENDVQGIVHLVASAIEGMNPEHVTVLDQKGKLLSKNTPGD
FT                   AAGKMTASMQEVQRAYERSTEERLQSLLDKAVGAGKSVARVSAVFDFRQVERYEEKYDP
FT                   ETVVRSEQRSEEKQDGSTVTGGVPGVQTNLGRTAGQPAGTSGGGSKNDETLNYEVSRAT
FT                   ARTIEPVGTLSKVSVAILVDGKYDAAAAGKDGKEAKPKYTPRSPDELQKIDALVKSSVG
FT                   FNVERGDQVTVVNIPFQDTGDVGAGEADKWWNAPIFLSLLKNGLIGFGFLALLLFVVRP
FT                   LLKTLKPEKSTSFEPIPSAEDALNQIAEIHRLQIGNQTVSQMELINKIKQEPYQAAQII
FT                   QNWLRDKGEE"
     MPEALNKLIQ PFMALPPAKR WVVGGVVGLS VIAFTILILV ANRTDYRPLF TNLTSEDAGE        60
     IVTKLKEQKV PYRIAADGKA ILVPSDKVYD LRLSLASDGL PQGGGVGFEI FDRKNFGMTD       120
     FVQKLNYQRA LQGELSRTIS QISGVEQARV HLVIPEKSLF KEDEKPATAS VVLKVKGQRQ       180
     LRENDVQGIV HLVASAIEGM NPEHVTVLDQ KGKLLSKNTP GDAAGKMTAS MQEVQRAYER       240
     STEERLQSLL DKAVGAGKSV ARVSAVFDFR QVERYEEKYD PETVVRSEQR SEEKQDGSTV       300
     TGGVPGVQTN LGRTAGQPAG TSGGGSKNDE TLNYEVSRAT ARTIEPVGTL SKVSVAILVD       360
     GKYDAAAAGK DGKEAKPKYT PRSPDELQKI DALVKSSVGF NVERGDQVTV VNIPFQDTGD       420
     VGAGEADKWW NAPIFLSLLK NGLIGFGFLA LLLFVVRPLL KTLKPEKSTS FEPIPSAEDA       480
     LNQIAEIHRL QIGNQTVSQM ELINKIKQEP YQAAQIIQNW LRDKGEE                     527
//

If you have problems or comments...

PBIL Back to PBIL home page