(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIG

CP002031.FLIG        Location/Qualifiers
FT   CDS             408139..409131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="KN400_0379"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83242"
FT                   /protein_id="ADI83242.1"
FT                   /translation="MTGTDKAAILLLYLGPEATSKVFEHLDDDEIKKISKSMATLGHVP
FT                   RNVIQDVVTEYSSLTNPDTGIFSQGEEFVRKILEQTLGPQKAEILLKELQSSSFGDMVD
FT                   VLANLDAKSIANFLSQEHPQTIAVILAKLRAKQTSEIISMLPQGLQAEVVMRIADVDQV
FT                   SPEILADIDEVIKRELTAMGGVQRYKVGGVEKVVDMFNHLDRSKEKQILEKLDTLNPPL
FT                   AEVIRKHLFTFEDIFKLDDRSIQAIMREVSNDTLTLAMKTAPDEIKDKIFRNISSRAAE
FT                   MIKEDLEVMGPVRLSDVEKGQSEIIKIVRRMEEEGKVVLAGRGGDDVLV"
     MTGTDKAAIL LLYLGPEATS KVFEHLDDDE IKKISKSMAT LGHVPRNVIQ DVVTEYSSLT        60
     NPDTGIFSQG EEFVRKILEQ TLGPQKAEIL LKELQSSSFG DMVDVLANLD AKSIANFLSQ       120
     EHPQTIAVIL AKLRAKQTSE IISMLPQGLQ AEVVMRIADV DQVSPEILAD IDEVIKRELT       180
     AMGGVQRYKV GGVEKVVDMF NHLDRSKEKQ ILEKLDTLNP PLAEVIRKHL FTFEDIFKLD       240
     DRSIQAIMRE VSNDTLTLAM KTAPDEIKDK IFRNISSRAA EMIKEDLEVM GPVRLSDVEK       300
     GQSEIIKIVR RMEEEGKVVL AGRGGDDVLV                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page