(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIJ

CP002031.FLIJ        Location/Qualifiers
FT   CDS             411377..411817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="KN400_0382"
FT                   /product="flagellar export protein FliJ"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83245"
FT                   /protein_id="ADI83245.1"
FT                   /translation="MTHKHGFQLQQVLNYRKEVEKVKKLEFATARHEFEHATDVLSRHE
FT                   AEADRARVEYNNKQAAGTTANELQLYADFFARKHMDIQFQRIEVDNLNRKMSEKREDLM
FT                   DAAKDKKALELLKEKQMLAFRREMAERERAFLDEMALQKVAR"
     MTHKHGFQLQ QVLNYRKEVE KVKKLEFATA RHEFEHATDV LSRHEAEADR ARVEYNNKQA        60
     AGTTANELQL YADFFARKHM DIQFQRIEVD NLNRKMSEKR EDLMDAAKDK KALELLKEKQ       120
     MLAFRREMAE RERAFLDEMA LQKVAR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page