(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIM

CP002031.FLIM        Location/Qualifiers
FT   CDS             417418..418404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="KN400_0389"
FT                   /product="flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83252"
FT                   /protein_id="ADI83252.1"
FT                   /translation="MEKILTKQEIEALLAAVFEGKIEPDRELAKEEGTVHSYDLFNSEA
FT                   HKGLVPNLDIIYDGFIRYQRGTLSNRLGRIVEIKKLGAGSYKFDDFIQTLPSPVCMAIY
FT                   KADPLKGAALIAFDSTLVFTIVDCILGGTGMTSVQTSANRMFTSIELRLVQKIVQDMLV
FT                   DLEKAWAPLYAAKMSLLRMEMNPRLVNIVPPEYQVVTMEMQIQIDQLEGKMVFAVPYMT
FT                   IEPIRDKLKSGAQFDLMAIDPQWSFRLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGD
FT                   TIMLDTPCTSDLTVKVGGVPKFTGMPGIRHGNKALQITNVVGKGEQR"
     MEKILTKQEI EALLAAVFEG KIEPDRELAK EEGTVHSYDL FNSEAHKGLV PNLDIIYDGF        60
     IRYQRGTLSN RLGRIVEIKK LGAGSYKFDD FIQTLPSPVC MAIYKADPLK GAALIAFDST       120
     LVFTIVDCIL GGTGMTSVQT SANRMFTSIE LRLVQKIVQD MLVDLEKAWA PLYAAKMSLL       180
     RMEMNPRLVN IVPPEYQVVT MEMQIQIDQL EGKMVFAVPY MTIEPIRDKL KSGAQFDLMA       240
     IDPQWSFRLS KELLEAPLDV SVEVGGAVIS LNDLLSLVPG DTIMLDTPCT SDLTVKVGGV       300
     PKFTGMPGIR HGNKALQITN VVGKGEQR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page