(data stored in SCRATCH3701 zone)

EMBL: CP002031.FLIP

CP002031.FLIP        Location/Qualifiers
FT   CDS             419206..419973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="KN400_0392"
FT                   /product="flagellar biogenesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83255"
FT                   /protein_id="ADI83255.1"
FT                   /translation="MDGVPIFKRIPFIALCVILLTASLAAAAEPLALPSVSIGVGKATK
FT                   PGDVSVVLQIFFLMTVLSLAPGLLMMTTSFTRIAVVLSFLRHAIGTQQAPPNQIIIALS
FT                   LFLTFFVMAPVWQQVNTQAIQPYRAAQITQDEALKRAVAPMRKFMLSQTREKDLALFLN
FT                   LSKLPRPRTADDIPTLTLIPAFMISELRTAFQIGFLIFIPFLVVDMVVASVLMSMGMMM
FT                   LPPVMISLPFKILLFVLVDGWGLVIGSLIKSFG"
     MDGVPIFKRI PFIALCVILL TASLAAAAEP LALPSVSIGV GKATKPGDVS VVLQIFFLMT        60
     VLSLAPGLLM MTTSFTRIAV VLSFLRHAIG TQQAPPNQII IALSLFLTFF VMAPVWQQVN       120
     TQAIQPYRAA QITQDEALKR AVAPMRKFML SQTREKDLAL FLNLSKLPRP RTADDIPTLT       180
     LIPAFMISEL RTAFQIGFLI FIPFLVVDMV VASVLMSMGM MMLPPVMISL PFKILLFVLV       240
     DGWGLVIGSL IKSFG                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page