(data stored in SCRATCH3701 zone)

EMBL: CP002031.FXSA

CP002031.FXSA        Location/Qualifiers
FT   CDS             complement(840426..840818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fxsA"
FT                   /locus_tag="KN400_0785"
FT                   /product="cytoplasmic membrane protein FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83648"
FT                   /protein_id="ADI83648.1"
FT                   /translation="MLLRLFLIFSVVPIIELYLLIRVGKLIGALPTVALLLVVSLAGAW
FT                   LVRSQGFVILRRIQDELAMGRLPAAGLLDGALVLLGGLLLLTPGFFSDVVGLFFIIPPT
FT                   RAVIKQFLGLWLQNRLARGQFVIRRF"
     MLLRLFLIFS VVPIIELYLL IRVGKLIGAL PTVALLLVVS LAGAWLVRSQ GFVILRRIQD        60
     ELAMGRLPAA GLLDGALVLL GGLLLLTPGF FSDVVGLFFI IPPTRAVIKQ FLGLWLQNRL       120
     ARGQFVIRRF                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page