(data stored in SCRATCH3701 zone)

EMBL: CP002031.GLYS

CP002031.GLYS        Location/Qualifiers
FT   CDS             587025..589088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="KN400_0557"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83420"
FT                   /protein_id="ADI83420.1"
FT                   /translation="MSKELFLEIGTEEIPAGFLPKAMADMEAIVTKELENARLAFGEVK
FT                   TFATPRRLALVVKGLPTVQPDAEITALGPARNIAFGPDGTPSKAAEGFARGQGVDVASL
FT                   TLVSTEKGEYVAAVRKESGRPVPDLLAEILPRLVGGIPFRKSMRWADLDVRFARPIHWI
FT                   VALFDGVVVPFAFGNVQSGNVSRGHRFMANQPFPVRDFAHYLDECERHFVIPDPERRKE
FT                   TIRREIHRVAKTAGGHLLPDEGLLDEVAYLVEYPSVVHGTFSPDFLKVPREVLITSMRS
FT                   HQRYFSIVDDAGKLMPGFITINNTLTEDPSVVVKGNERVLRARLSDARFFFEEDQKVKL
FT                   ETRVESLKNVVYQQKLGTSYEKMERFRALAEGLADLLNPAVKAKTSRAAFLCKADLVSG
FT                   MVGEFPEVQGIMGREYALLQGEDAEVAAAIAEHYLPTQAGGDLPASDIGAFVSIADKLD
FT                   TICGCFGVGLIPTGSADPYALRRSALGIINIILDRGCRLSLEGEIGKALELLSAKLTRP
FT                   AAEVMADVLEFFRGRFVNLMADRYPADAVDAAIAAGFDDLVDAEARIGALAAFKGRPDF
FT                   DSLAVAFKRVCNIVKDGVDQPVDAALFQEPAEGALFAAFQQVRADVEARTASGDYLAAL
FT                   TGIAALKGAVDDFFDKVMVMAEDERVRTNRLALLTGIARLFGGVADFAKIAA"
     MSKELFLEIG TEEIPAGFLP KAMADMEAIV TKELENARLA FGEVKTFATP RRLALVVKGL        60
     PTVQPDAEIT ALGPARNIAF GPDGTPSKAA EGFARGQGVD VASLTLVSTE KGEYVAAVRK       120
     ESGRPVPDLL AEILPRLVGG IPFRKSMRWA DLDVRFARPI HWIVALFDGV VVPFAFGNVQ       180
     SGNVSRGHRF MANQPFPVRD FAHYLDECER HFVIPDPERR KETIRREIHR VAKTAGGHLL       240
     PDEGLLDEVA YLVEYPSVVH GTFSPDFLKV PREVLITSMR SHQRYFSIVD DAGKLMPGFI       300
     TINNTLTEDP SVVVKGNERV LRARLSDARF FFEEDQKVKL ETRVESLKNV VYQQKLGTSY       360
     EKMERFRALA EGLADLLNPA VKAKTSRAAF LCKADLVSGM VGEFPEVQGI MGREYALLQG       420
     EDAEVAAAIA EHYLPTQAGG DLPASDIGAF VSIADKLDTI CGCFGVGLIP TGSADPYALR       480
     RSALGIINII LDRGCRLSLE GEIGKALELL SAKLTRPAAE VMADVLEFFR GRFVNLMADR       540
     YPADAVDAAI AAGFDDLVDA EARIGALAAF KGRPDFDSLA VAFKRVCNIV KDGVDQPVDA       600
     ALFQEPAEGA LFAAFQQVRA DVEARTASGD YLAALTGIAA LKGAVDDFFD KVMVMAEDER       660
     VRTNRLALLT GIARLFGGVA DFAKIAA                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page