(data stored in SCRATCH3701 zone)

EMBL: CP002031.HDRB

CP002031.HDRB        Location/Qualifiers
FT   CDS             complement(70697..71587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrB"
FT                   /locus_tag="KN400_0066"
FT                   /product="heterodisulfide oxidoreductase, CCG domain
FT                   pair-containing subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82929"
FT                   /protein_id="ADI82929.1"
FT                   /translation="MTPAKNLLNYSYYPGCSLHASAKEYDESTRGLFRALKIGLHEVPD
FT                   WLCCGATPAHNVDELLSLSLCAKNLSLAEEVGGDLAVACAACFSRLKVTQHRLADNEEK
FT                   RRQVEYAIDGKVSFDNKVKHLLEILAKDFGLDRLTAAVRKPLEGLKVACYYGCLLTRPP
FT                   EVPELDDCEAPTIMERVIGAAGAETVTWSHRMECCGANFTLSRPGVVLKLSGDILASAK
FT                   AAGANCILVACPLCHGNLDIRQKEIEEASGQWFGMPVFYMTQLLALAVGVAPAKLGFDS
FT                   MIVNPLPLLKEKGLV"
     MTPAKNLLNY SYYPGCSLHA SAKEYDESTR GLFRALKIGL HEVPDWLCCG ATPAHNVDEL        60
     LSLSLCAKNL SLAEEVGGDL AVACAACFSR LKVTQHRLAD NEEKRRQVEY AIDGKVSFDN       120
     KVKHLLEILA KDFGLDRLTA AVRKPLEGLK VACYYGCLLT RPPEVPELDD CEAPTIMERV       180
     IGAAGAETVT WSHRMECCGA NFTLSRPGVV LKLSGDILAS AKAAGANCIL VACPLCHGNL       240
     DIRQKEIEEA SGQWFGMPVF YMTQLLALAV GVAPAKLGFD SMIVNPLPLL KEKGLV           296
//

If you have problems or comments...

PBIL Back to PBIL home page