(data stored in SCRATCH3701 zone)

EMBL: CP002031.HDRC

CP002031.HDRC        Location/Qualifiers
FT   CDS             complement(71584..72168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrC"
FT                   /locus_tag="KN400_0067"
FT                   /product="heterodisulfide oxidoreductase, iron-sulfur
FT                   cluster-binding subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82930"
FT                   /protein_id="ADI82930.1"
FT                   /translation="MKHSKMRLSTETMNLGFVRKVEALSGSSVRRCFQCGKCSAGCPMR
FT                   SFMEHPPNRIVRFLQLGQYERVLAGRSIWYCASCETCTTRCPNKVDLAAIMDALRKCSW
FT                   DAKGPSKESLVQLANRLFIENIRTYGRQYEMRLAAVFNVKSGQFLKDLMLGPKLITKGK
FT                   LRMFHQKNRNIAEIENIFARIEALRKKGEAP"
     MKHSKMRLST ETMNLGFVRK VEALSGSSVR RCFQCGKCSA GCPMRSFMEH PPNRIVRFLQ        60
     LGQYERVLAG RSIWYCASCE TCTTRCPNKV DLAAIMDALR KCSWDAKGPS KESLVQLANR       120
     LFIENIRTYG RQYEMRLAAV FNVKSGQFLK DLMLGPKLIT KGKLRMFHQK NRNIAEIENI       180
     FARIEALRKK GEAP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page