(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYAS

CP002031.HYAS        Location/Qualifiers
FT   CDS             complement(105421..106536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyaS"
FT                   /locus_tag="KN400_0098"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82961"
FT                   /protein_id="ADI82961.1"
FT                   /translation="MAGNDDGNDLVKQHCKSSGTWEEQGISRRDFLKFCTAMSAVLALP
FT                   VTLVPRIAEALEDDKRPSVIWLEFQSCTGDTEALLRAANPTVADIVLDVLSVDYAETIM
FT                   AAAGFQAEAARHATMKARSGTYIAVVEGAIPTGANGAYCCIGGRSALDITREVCGGAMA
FT                   TITVGTCASYGGIPAAAPNPTGAVGVKDAVPGATVINLPGCPVNTDNLVATVVHLLTFG
FT                   SPPATDGKGRPLFAYGKRIHDNCERRPHFDAGQYVEQWGDQAHRAGHCLYKMGCKGPET
FT                   FHNCPSQRYNEKTAWPVSAGHGCAGCSEPHFWDSMTPLYKRLPNVPGFGIEATADQIGL
FT                   GIAAATAAAFGIHGVVSALRKGNDSDDEKEG"
     MAGNDDGNDL VKQHCKSSGT WEEQGISRRD FLKFCTAMSA VLALPVTLVP RIAEALEDDK        60
     RPSVIWLEFQ SCTGDTEALL RAANPTVADI VLDVLSVDYA ETIMAAAGFQ AEAARHATMK       120
     ARSGTYIAVV EGAIPTGANG AYCCIGGRSA LDITREVCGG AMATITVGTC ASYGGIPAAA       180
     PNPTGAVGVK DAVPGATVIN LPGCPVNTDN LVATVVHLLT FGSPPATDGK GRPLFAYGKR       240
     IHDNCERRPH FDAGQYVEQW GDQAHRAGHC LYKMGCKGPE TFHNCPSQRY NEKTAWPVSA       300
     GHGCAGCSEP HFWDSMTPLY KRLPNVPGFG IEATADQIGL GIAAATAAAF GIHGVVSALR       360
     KGNDSDDEKE G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page