(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYBA

CP002031.HYBA        Location/Qualifiers
FT   CDS             819520..820437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hybA"
FT                   /locus_tag="KN400_0763"
FT                   /product="periplasmically oriented, membrane-bound
FT                   [NiFe]-hydrogenase, iron-sulfur cluster-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83626"
FT                   /protein_id="ADI83626.2"
FT                   /translation="MKSTTRRDFLKMMGMTGAACLACAAPLSASTGPAGESETAIAMLY
FT                   DATKCVGCKACMAACKRVNMEQNNLSYEYLPTDGDKLWDAPKDLSGDTRTVIKLYKESD
FT                   TRFSYVKHSCMHCTKPGCVSACPVKAMTKDPVTGVVAYNKNACIGCRYCQVACPYNIPR
FT                   FQWDKALPQIVKCDFCKDTNLKAKGMPACSETCPAGAIAFGKRTDLLAEAHNRIKENPD
FT                   RYIPKVYGEKEVGGANHLYLAAFPFQKLGLPELKEESPAAFSEHIQHTIYKGFIAPVAL
FT                   YGTLAAIALRNKKKQEDLGHGEDD"
     MKSTTRRDFL KMMGMTGAAC LACAAPLSAS TGPAGESETA IAMLYDATKC VGCKACMAAC        60
     KRVNMEQNNL SYEYLPTDGD KLWDAPKDLS GDTRTVIKLY KESDTRFSYV KHSCMHCTKP       120
     GCVSACPVKA MTKDPVTGVV AYNKNACIGC RYCQVACPYN IPRFQWDKAL PQIVKCDFCK       180
     DTNLKAKGMP ACSETCPAGA IAFGKRTDLL AEAHNRIKEN PDRYIPKVYG EKEVGGANHL       240
     YLAAFPFQKL GLPELKEESP AAFSEHIQHT IYKGFIAPVA LYGTLAAIAL RNKKKQEDLG       300
     HGEDD                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page