(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYPE

CP002031.HYPE        Location/Qualifiers
FT   CDS             307764..308777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="KN400_0278"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83141"
FT                   /protein_id="ADI83141.1"
FT                   /translation="MNKELILLGHGSGGKLSHQLLDDLIIPTLSGISLAGQNDAALVDA
FT                   DGRRLAFTTDSYVVDPVFFPGGNIGTLAVNGTVNDLAMMGARPLFLSAGLIIEEGFSRN
FT                   DLGTILASMRQAADAAGVRIVTGDTKVVPRGKADRIFINTSGIGLVEHDFTISGACARP
FT                   GDRIIINGTVGDHGIAVMAKREGLELLTDIVSDCAPLNGLVADIIAEGGGDVHVLRDPT
FT                   RGGVATTLKEIALQSDVTIMIREEAIPLAGPVKGVCAILGLDPLYVANEGKLLVAVAPS
FT                   AAERVLARMKTHPCGGAAAIIGEVTDAGGGKLRLETSVGGVRAVEMLAGEQLPRIC"
     MNKELILLGH GSGGKLSHQL LDDLIIPTLS GISLAGQNDA ALVDADGRRL AFTTDSYVVD        60
     PVFFPGGNIG TLAVNGTVND LAMMGARPLF LSAGLIIEEG FSRNDLGTIL ASMRQAADAA       120
     GVRIVTGDTK VVPRGKADRI FINTSGIGLV EHDFTISGAC ARPGDRIIIN GTVGDHGIAV       180
     MAKREGLELL TDIVSDCAPL NGLVADIIAE GGGDVHVLRD PTRGGVATTL KEIALQSDVT       240
     IMIREEAIPL AGPVKGVCAI LGLDPLYVAN EGKLLVAVAP SAAERVLARM KTHPCGGAAA       300
     IIGEVTDAGG GKLRLETSVG GVRAVEMLAG EQLPRIC                                337
//

If you have problems or comments...

PBIL Back to PBIL home page