(data stored in SCRATCH3701 zone)

EMBL: CP002031.HYPF

CP002031.HYPF        Location/Qualifiers
FT   CDS             304124..306415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="KN400_0275"
FT                   /product="hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83138"
FT                   /protein_id="ADI83138.1"
FT                   /translation="MVLRLRIAVEGIVQGVGFRPFIFRLAAHHGIVGWVMNSGAGVVME
FT                   AEGDAGALAAFRSAIVSDAPPLAVIARIAIEEIAPQGDGSFVIGESGEGAGTVRVAPDG
FT                   DVCPDCLRELFDPSDRRYRYPFINCTNCGPRYSLVTAVPYDRSNTTMARFPLCDACRSE
FT                   YEDPMDRRFHAQPVACPDCGPTLRLVDASGAGLPGDPVDQTVELLTEGKIVAIKGLGGY
FT                   HLAVDAANDAAVAELRRRKHRDEKPFAVMARDMEAVARFALVDSVEARLLTGPEHPIVL
FT                   LRKRPSTILSGRVAPANGYIGTMLPYTPLHHLLLEERFAALVMTSGNLSDEPISYRDDE
FT                   AVERLSAIADAFLVHDREIRTRIDDSVIRVFRGSPLFLRRSRGYVPREVRLPVEIPPVL
FT                   AVGAELKGALCLTRGDRAFPSQHIGDLKNDTTLTSLAATAEHLQALLEIRPQLVAHDLH
FT                   PDYLSTGYAEGIAGLPRVAVQHHHAHLASCMADNGLDGSVIGVIFDGTGLGTDGTVWGG
FT                   EFLVGGYDGFRRAAHFRQVPLPGGDAAVREPYRMALAYLHDAFGADFFEQPVPWLTEVG
FT                   DEDRSLFLRMLERRINSPLTSSCGRLFDAVAAMVGLRRTVSYEGQAAIELEGQAEESAT
FT                   GRAYPFAVLSRQGAIEVDYRLMIRALMEDLAVQVSLPEMARAFHNTVAASVVDVCRKVR
FT                   SETGLDRIVLSGGVFQNRLLCEESCRLLEAEGFRVFTHRLVPPNDGGVALGQAVIAGVA
FT                   HRVPRSDKGE"
     MVLRLRIAVE GIVQGVGFRP FIFRLAAHHG IVGWVMNSGA GVVMEAEGDA GALAAFRSAI        60
     VSDAPPLAVI ARIAIEEIAP QGDGSFVIGE SGEGAGTVRV APDGDVCPDC LRELFDPSDR       120
     RYRYPFINCT NCGPRYSLVT AVPYDRSNTT MARFPLCDAC RSEYEDPMDR RFHAQPVACP       180
     DCGPTLRLVD ASGAGLPGDP VDQTVELLTE GKIVAIKGLG GYHLAVDAAN DAAVAELRRR       240
     KHRDEKPFAV MARDMEAVAR FALVDSVEAR LLTGPEHPIV LLRKRPSTIL SGRVAPANGY       300
     IGTMLPYTPL HHLLLEERFA ALVMTSGNLS DEPISYRDDE AVERLSAIAD AFLVHDREIR       360
     TRIDDSVIRV FRGSPLFLRR SRGYVPREVR LPVEIPPVLA VGAELKGALC LTRGDRAFPS       420
     QHIGDLKNDT TLTSLAATAE HLQALLEIRP QLVAHDLHPD YLSTGYAEGI AGLPRVAVQH       480
     HHAHLASCMA DNGLDGSVIG VIFDGTGLGT DGTVWGGEFL VGGYDGFRRA AHFRQVPLPG       540
     GDAAVREPYR MALAYLHDAF GADFFEQPVP WLTEVGDEDR SLFLRMLERR INSPLTSSCG       600
     RLFDAVAAMV GLRRTVSYEG QAAIELEGQA EESATGRAYP FAVLSRQGAI EVDYRLMIRA       660
     LMEDLAVQVS LPEMARAFHN TVAASVVDVC RKVRSETGLD RIVLSGGVFQ NRLLCEESCR       720
     LLEAEGFRVF THRLVPPNDG GVALGQAVIA GVAHRVPRSD KGE                         763
//

If you have problems or comments...

PBIL Back to PBIL home page