(data stored in SCRATCH3701 zone)

EMBL: CP002031.MCP40H-11

CP002031.MCP40H-11   Location/Qualifiers
FT   CDS             396571..398220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp40H-11"
FT                   /locus_tag="KN400_0368"
FT                   /product="methyl-accepting chemotaxis sensory transducer,
FT                   class 40H, Cache_2 domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83231"
FT                   /protein_id="ADI83231.1"
FT                   /translation="MQIKRYRNWGILPKIMTISGITVVLIAALVLFVLLPLIGEKMMDG
FT                   KKEKTKSVVEVAYNLVADLGERAKRGEISEEEARKRAIDHVKQLRYQGKEYFWINDLTP
FT                   RMIMHPIKPELDGTDLSENKDPRGTYLFREFANICREKGEGFVPYLWPKPGASEPVEKI
FT                   SYVKLYEPWGWVIGSGIYVDDVRADMARLRWVVLGGTALFGLFALSLAFSVGLGVVRPL
FT                   RHAVTSLQDIAEGEGDLTRRIAVEREDESGELALAFNRFVEKLQGIVGTVANNALQVAA
FT                   AAGQVQEASRQMAEAAENVAGQAATVATASEEMAATSMEIAGNCVSLADGARHASETAE
FT                   SGAAVVQETVSVMGRIAERVKEAARTVDSLGSRSDQIGEIIGTIEDIADQTNLLALNAA
FT                   IEAARAGESGRGFAVVADEVRALAERTTRATREIALMIKAIQNETRGAVASMDEGVREV
FT                   EKGTGEAARSGAALREILEQIGSVSLQISQIATAAEQQTSTTTEISGSIQTITDTAHET
FT                   ARGAQESAGAAGQLADLAEQLQNVVMTFRLSA"
     MQIKRYRNWG ILPKIMTISG ITVVLIAALV LFVLLPLIGE KMMDGKKEKT KSVVEVAYNL        60
     VADLGERAKR GEISEEEARK RAIDHVKQLR YQGKEYFWIN DLTPRMIMHP IKPELDGTDL       120
     SENKDPRGTY LFREFANICR EKGEGFVPYL WPKPGASEPV EKISYVKLYE PWGWVIGSGI       180
     YVDDVRADMA RLRWVVLGGT ALFGLFALSL AFSVGLGVVR PLRHAVTSLQ DIAEGEGDLT       240
     RRIAVEREDE SGELALAFNR FVEKLQGIVG TVANNALQVA AAAGQVQEAS RQMAEAAENV       300
     AGQAATVATA SEEMAATSME IAGNCVSLAD GARHASETAE SGAAVVQETV SVMGRIAERV       360
     KEAARTVDSL GSRSDQIGEI IGTIEDIADQ TNLLALNAAI EAARAGESGR GFAVVADEVR       420
     ALAERTTRAT REIALMIKAI QNETRGAVAS MDEGVREVEK GTGEAARSGA ALREILEQIG       480
     SVSLQISQIA TAAEQQTSTT TEISGSIQTI TDTAHETARG AQESAGAAGQ LADLAEQLQN       540
     VVMTFRLSA                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page