(data stored in SCRATCH3701 zone)

EMBL: CP002031.MGLB

CP002031.MGLB        Location/Qualifiers
FT   CDS             81788..82279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB"
FT                   /locus_tag="KN400_0074"
FT                   /product="cell polarity determinant GTPase-activating
FT                   protein MglB"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82937"
FT                   /protein_id="ADI82937.1"
FT                   /translation="MSYPQMVMYDEEFKLINAVIEKLLREANAKVIFLVDKNGQLISGV
FT                   GETERFDTTSLASLTAGNIAATGGLAKLIGEKEFSILFHEGEKDNLHISIVGGRVILVV
FT                   LFDNRSSLGLVRLRVKKASDELTTVFDRLMKKAEEKERSGIQEFPFAEITDDDIDNLFS
FT                   "
     MSYPQMVMYD EEFKLINAVI EKLLREANAK VIFLVDKNGQ LISGVGETER FDTTSLASLT        60
     AGNIAATGGL AKLIGEKEFS ILFHEGEKDN LHISIVGGRV ILVVLFDNRS SLGLVRLRVK       120
     KASDELTTVF DRLMKKAEEK ERSGIQEFPF AEITDDDIDN LFS                         163
//

If you have problems or comments...

PBIL Back to PBIL home page