(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOH-1

CP002031.NUOH-1      Location/Qualifiers
FT   CDS             341150..342196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH-1"
FT                   /locus_tag="KN400_0313"
FT                   /product="NADH dehydrogenase I, H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83176"
FT                   /protein_id="ADI83176.1"
FT                   /translation="MGYELFGLPMIYYISMVAKVLVVFVFVLLTVAYATYAERKIIGHM
FT                   QVRLGPMRTGWHGLLQPIADGLKLFFKEEIVPSQADKFAFLIAPIIALVPAFIGFAVIP
FT                   FGETIEVAGYKIPLQIAGYYDTVSGQVVDMNVGVLYILALASIGVYGIVLAGWSSNSKY
FT                   SLLGGLRSSAQMISYELAAGLAIISVFMLSESLSLQKIVADQANGAWYCFKQPLAFILF
FT                   FICSLAEINRTPFDLPEAETELVSGFCTEYSSMKYAMFFMAEYANMVTVCAVTTTLFLG
FT                   GWHGPAFLPGWAWFIAKVYFLIFVCMWIRATYPRYRYDQLMRLGWKVFLPLTLVNIIVT
FT                   GIVVSLQS"
     MGYELFGLPM IYYISMVAKV LVVFVFVLLT VAYATYAERK IIGHMQVRLG PMRTGWHGLL        60
     QPIADGLKLF FKEEIVPSQA DKFAFLIAPI IALVPAFIGF AVIPFGETIE VAGYKIPLQI       120
     AGYYDTVSGQ VVDMNVGVLY ILALASIGVY GIVLAGWSSN SKYSLLGGLR SSAQMISYEL       180
     AAGLAIISVF MLSESLSLQK IVADQANGAW YCFKQPLAFI LFFICSLAEI NRTPFDLPEA       240
     ETELVSGFCT EYSSMKYAMF FMAEYANMVT VCAVTTTLFL GGWHGPAFLP GWAWFIAKVY       300
     FLIFVCMWIR ATYPRYRYDQ LMRLGWKVFL PLTLVNIIVT GIVVSLQS                    348
//

If you have problems or comments...

PBIL Back to PBIL home page