(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOI-1

CP002031.NUOI-1      Location/Qualifiers
FT   CDS             342218..342616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI-1"
FT                   /locus_tag="KN400_0314"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83177"
FT                   /protein_id="ADI83177.1"
FT                   /translation="MIMPLINGLKITLKHMFMKPVTLQYPDERPTPSPNFRGLHALKVS
FT                   HDKAKCVACYLCPTVCPAKCITVEAGEDATHDKYAERYEIDMLRCIFCGYCVEACPVDA
FT                   LKMTGQFELANYKREDFIFVKERLLEKK"
     MIMPLINGLK ITLKHMFMKP VTLQYPDERP TPSPNFRGLH ALKVSHDKAK CVACYLCPTV        60
     CPAKCITVEA GEDATHDKYA ERYEIDMLRC IFCGYCVEAC PVDALKMTGQ FELANYKRED       120
     FIFVKERLLE KK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page