(data stored in SCRATCH3701 zone)

EMBL: CP002031.NUOM-1

CP002031.NUOM-1      Location/Qualifiers
FT   CDS             345539..347107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM-1"
FT                   /locus_tag="KN400_0318"
FT                   /product="NADH dehydrogenase I, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83181"
FT                   /protein_id="ADI83181.1"
FT                   /translation="MSQFPLISVMTFLPLLGVVLLFFVPKQSHSVHRMLALLVSLVTFV
FT                   VSIPLVTGFQSNADFQFVEKMPWIAAGPFQMNYHVAIDGISLWLVLLTTFIMPIAILST
FT                   WTAVEEKVKEYMICLLLLEVGMLGAFVSLDLFLFYIFWEVMLIPMYFIIGIWGGKNKIY
FT                   AAVKFFIYTMVGSMLMLVALVTLYFKAGAGDFNVLRFYEVTLDPATQVWMFLAFALAFA
FT                   IKVPMFPLHTWLPDAHTEAPTAGSVILAAVLLKMGTYGFVRFAMPLFPDATDKFTPLIA
FT                   TLSVIGIIYAALVAMVQEDVKKLVAYSSVAHLGYVMLGVFALNLQGLSGGMLQMLNHGV
FT                   STGALFLIVGFIYERRHTRLITDFGGLAKQMPVFATIFMIVTLSSIGLPGTNGFVGEFL
FT                   VLLGAFESELRWYAVIGTSGVILAAVYMLWMFQRVMFGELTNPKNQTLCDLNAREVGIM
FT                   LPLLVLIFVMGVYPTPFIEKMSPSLEKLIVHVKTKQQGAVAQVETVPAAPQVMPAAAVV
FT                   PAEHK"
     MSQFPLISVM TFLPLLGVVL LFFVPKQSHS VHRMLALLVS LVTFVVSIPL VTGFQSNADF        60
     QFVEKMPWIA AGPFQMNYHV AIDGISLWLV LLTTFIMPIA ILSTWTAVEE KVKEYMICLL       120
     LLEVGMLGAF VSLDLFLFYI FWEVMLIPMY FIIGIWGGKN KIYAAVKFFI YTMVGSMLML       180
     VALVTLYFKA GAGDFNVLRF YEVTLDPATQ VWMFLAFALA FAIKVPMFPL HTWLPDAHTE       240
     APTAGSVILA AVLLKMGTYG FVRFAMPLFP DATDKFTPLI ATLSVIGIIY AALVAMVQED       300
     VKKLVAYSSV AHLGYVMLGV FALNLQGLSG GMLQMLNHGV STGALFLIVG FIYERRHTRL       360
     ITDFGGLAKQ MPVFATIFMI VTLSSIGLPG TNGFVGEFLV LLGAFESELR WYAVIGTSGV       420
     ILAAVYMLWM FQRVMFGELT NPKNQTLCDL NAREVGIMLP LLVLIFVMGV YPTPFIEKMS       480
     PSLEKLIVHV KTKQQGAVAQ VETVPAAPQV MPAAAVVPAE HK                          522
//

If you have problems or comments...

PBIL Back to PBIL home page