(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE105

CP002031.PE105       Location/Qualifiers
FT   CDS             113986..114741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0107"
FT                   /product="protein of unknown function DUF116"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82970"
FT                   /protein_id="ADI82970.1"
FT                   /translation="MAEHPPQKRLFIALMGLTCLLIVGGIYLLWWVPTTGLANIHPSLP
FT                   RVVGIVLGGLSLLALLGTAVLVLTTALGKDMYFTRFLRGVVIKFLLPVIELLGRAFGIS
FT                   TDTIRQSFIAMNNSLVLSQRYKVKPDRILILLPHCLQLFDCEIKVTGDINKCIRCGRCD
FT                   IKGLAELAEKYRIDISVATGGTLARKVIIEKRPKLVVAVACERDLTSGIKDCYPLPVIG
FT                   VLNDRPFGPCFNTSVDIAKIDESLQVIMG"
     MAEHPPQKRL FIALMGLTCL LIVGGIYLLW WVPTTGLANI HPSLPRVVGI VLGGLSLLAL        60
     LGTAVLVLTT ALGKDMYFTR FLRGVVIKFL LPVIELLGRA FGISTDTIRQ SFIAMNNSLV       120
     LSQRYKVKPD RILILLPHCL QLFDCEIKVT GDINKCIRCG RCDIKGLAEL AEKYRIDISV       180
     ATGGTLARKV IIEKRPKLVV AVACERDLTS GIKDCYPLPV IGVLNDRPFG PCFNTSVDIA       240
     KIDESLQVIM G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page