(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE110

CP002031.PE110       Location/Qualifiers
FT   CDS             119248..119685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0112"
FT                   /product="DoxX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82975"
FT                   /protein_id="ADI82975.1"
FT                   /translation="MAKSNMGAVADSLALLMIRVPLGAIFIAHGSQKLLGAFGGQGLTA
FT                   TFRVFEEKLGIPPIFTLLAIIAEFGGGVGVLCGFLTRLSGFGIASTMAVAMYKVHWANG
FT                   FFLNGPRGNGIEYNLALLGMALALVFAGGGAWSVDRYLFKR"
     MAKSNMGAVA DSLALLMIRV PLGAIFIAHG SQKLLGAFGG QGLTATFRVF EEKLGIPPIF        60
     TLLAIIAEFG GGVGVLCGFL TRLSGFGIAS TMAVAMYKVH WANGFFLNGP RGNGIEYNLA       120
     LLGMALALVF AGGGAWSVDR YLFKR                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page