(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE111

CP002031.PE111       Location/Qualifiers
FT   CDS             complement(119836..120534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0113"
FT                   /product="PilZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82976"
FT                   /protein_id="ADI82976.1"
FT                   /translation="MHDYYQLVTVADLPQDNRQILDTLTAIGAGKLPNDLRLLNYYRSI
FT                   PVNYGATVESVERGSVELTVNQQQAIVMQLEKQVFLKSGHFPKDVLAAVTYVNIDKSVA
FT                   ILANFAYAVIRSERRQFVRVEVKDKIEASFSGDGFTVAGLLNDISLGGVAISATIPTHP
FT                   DAGIKGKVTLRLPGGPFEMPAQVLRVIPAKQTDLCIIEIQPDNRTEKGISQYIFQRQVE
FT                   IIRELKDSIF"
     MHDYYQLVTV ADLPQDNRQI LDTLTAIGAG KLPNDLRLLN YYRSIPVNYG ATVESVERGS        60
     VELTVNQQQA IVMQLEKQVF LKSGHFPKDV LAAVTYVNID KSVAILANFA YAVIRSERRQ       120
     FVRVEVKDKI EASFSGDGFT VAGLLNDISL GGVAISATIP THPDAGIKGK VTLRLPGGPF       180
     EMPAQVLRVI PAKQTDLCII EIQPDNRTEK GISQYIFQRQ VEIIRELKDS IF               232
//

If you have problems or comments...

PBIL Back to PBIL home page