(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE114

CP002031.PE114       Location/Qualifiers
FT   CDS             123313..124062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0116"
FT                   /product="phosphoribosylaminoimidazole carboxylase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82979"
FT                   /protein_id="ADI82979.1"
FT                   /translation="MDPRELKTILRSFKDGALSEDEMLERLRHLPYEDVGDALVDHHRG
FT                   LRQGFPEVIFGAGKSAGQVERIMASLAAKGNNILVTRLDEAKALAVKEAFPSAMWHADA
FT                   RCLTLEQRPIEKRGLGTVLVLSAGTSDLPVAAEALVTLRMLGNEASHLYDVGVAGIHRL
FT                   LARRDVLFSARVLIVVAGMEGALPSVVGGLVDRPVIAVPTSVGYGASFGGIAALLGMLN
FT                   SCAAGVTVVNIDNGFGAAVAASKINRE"
     MDPRELKTIL RSFKDGALSE DEMLERLRHL PYEDVGDALV DHHRGLRQGF PEVIFGAGKS        60
     AGQVERIMAS LAAKGNNILV TRLDEAKALA VKEAFPSAMW HADARCLTLE QRPIEKRGLG       120
     TVLVLSAGTS DLPVAAEALV TLRMLGNEAS HLYDVGVAGI HRLLARRDVL FSARVLIVVA       180
     GMEGALPSVV GGLVDRPVIA VPTSVGYGAS FGGIAALLGM LNSCAAGVTV VNIDNGFGAA       240
     VAASKINRE                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page