(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE136

CP002031.PE136       Location/Qualifiers
FT   CDS             148959..149246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83001"
FT                   /protein_id="ADI83001.1"
FT                   /translation="MGATLVLRNKKVREGIIIELAVWILDAPVDGCSHRFKYRLFCGVL
FT                   ETGSSLVRYDNERGKGDHRHVVDGEQPYVFTSLEKLFADFEGDVREVLKK"
     MGATLVLRNK KVREGIIIEL AVWILDAPVD GCSHRFKYRL FCGVLETGSS LVRYDNERGK        60
     GDHRHVVDGE QPYVFTSLEK LFADFEGDVR EVLKK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page