(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE141

CP002031.PE141       Location/Qualifiers
FT   CDS             152145..153311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0142"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83005"
FT                   /protein_id="ADI83005.2"
FT                   /translation="MFTEVSPRGGRLVVQQKGAEGYSAFVPHPLPPNPPLQIDDEMGWL
FT                   MERANRALGRLDGCTYTLPNPDLFLYMYVRKEAVLSSQIEGTQASLDDLLEYEGEIEGK
FT                   SSPDDINEVSNYVDAMNYGLERLQELPLSLRLIKEIHARLMAGIRGGHKSPGEFRTSQN
FT                   WIGGTRPGNAAFVPPPANEVVTCLGDLEKFLHDESVPPLLKAGLAHAQFETIHPFLDGN
FT                   GRMGRLLIAFILCHDQVLEKPLLYLSLFFKKHRQEYYERLNAVRRDGDWEGWIKYYLQG
FT                   VYEISKQATDAAKAIMDLMARDRQKVTGLGKAAPTALALLEMLYRKPYVTIPYVARELR
FT                   ISSPAASKAVNNLAALGILIEVSGKKRDRVFLHESYLSIIREGTELYR"
     MFTEVSPRGG RLVVQQKGAE GYSAFVPHPL PPNPPLQIDD EMGWLMERAN RALGRLDGCT        60
     YTLPNPDLFL YMYVRKEAVL SSQIEGTQAS LDDLLEYEGE IEGKSSPDDI NEVSNYVDAM       120
     NYGLERLQEL PLSLRLIKEI HARLMAGIRG GHKSPGEFRT SQNWIGGTRP GNAAFVPPPA       180
     NEVVTCLGDL EKFLHDESVP PLLKAGLAHA QFETIHPFLD GNGRMGRLLI AFILCHDQVL       240
     EKPLLYLSLF FKKHRQEYYE RLNAVRRDGD WEGWIKYYLQ GVYEISKQAT DAAKAIMDLM       300
     ARDRQKVTGL GKAAPTALAL LEMLYRKPYV TIPYVARELR ISSPAASKAV NNLAALGILI       360
     EVSGKKRDRV FLHESYLSII REGTELYR                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page