(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE144

CP002031.PE144       Location/Qualifiers
FT   CDS             155603..156058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0145"
FT                   /product="protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83008"
FT                   /protein_id="ADI83008.1"
FT                   /translation="MKIWIDADACPRAVKEILFRASTRLRVPLCLVANRSLAKHAGPLV
FT                   ESVVVADGFDVADDYIAEHAAPTDLVVTADVPLAARIVAKGGVALDPRGELYSEESIGE
FT                   RLAMRDLLSELRDTGMIQGGGPAPFSMSDRNRFASALDSLLHRMLRR"
     MKIWIDADAC PRAVKEILFR ASTRLRVPLC LVANRSLAKH AGPLVESVVV ADGFDVADDY        60
     IAEHAAPTDL VVTADVPLAA RIVAKGGVAL DPRGELYSEE SIGERLAMRD LLSELRDTGM       120
     IQGGGPAPFS MSDRNRFASA LDSLLHRMLR R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page