(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE146

CP002031.PE146       Location/Qualifiers
FT   CDS             156887..157618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0147"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83010"
FT                   /protein_id="ADI83010.1"
FT                   /translation="MYQEPEPGLYRHYKGGEYRVVGTARHSETDEPMVVYRCLYDNNSL
FT                   WVRPLAMFLGTVAVDGAERPRFSLVAPDRSGGPAAAELIAGLGLERHPEGGWYRETYRA
FT                   AGTIPGTLLPGQVGGERSFSTAIYFLLERGDISALHRIRSDELWHFHAGAPLIVHVITP
FT                   AGGSYALTLGSDPASGETFQAVVPAGCWFGAETTGDYSLVGCTVAPGFDFADFEMGSRA
FT                   DLLGRFPTHAGIIRRLTRDGD"
     MYQEPEPGLY RHYKGGEYRV VGTARHSETD EPMVVYRCLY DNNSLWVRPL AMFLGTVAVD        60
     GAERPRFSLV APDRSGGPAA AELIAGLGLE RHPEGGWYRE TYRAAGTIPG TLLPGQVGGE       120
     RSFSTAIYFL LERGDISALH RIRSDELWHF HAGAPLIVHV ITPAGGSYAL TLGSDPASGE       180
     TFQAVVPAGC WFGAETTGDY SLVGCTVAPG FDFADFEMGS RADLLGRFPT HAGIIRRLTR       240
     DGD                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page