(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE153

CP002031.PE153       Location/Qualifiers
FT   CDS             162645..163154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83017"
FT                   /protein_id="ADI83017.1"
FT                   /translation="MHHLKYLTGYPPQLTAQVAQLVTENRLGEVLVQRYPTVHDVRTDR
FT                   ALYDFTVAVKNEFMRTAQPLSRVLYDGKIHAIKNALGTHTFVSRVQGGKLKAKHEIRIA
FT                   SIFREAPLEFLKMIVVHELAHLKEKEHNKAFYQLCEYMEPRYHQLEFDTRLFLTQVEIA
FT                   GSPYLP"
     MHHLKYLTGY PPQLTAQVAQ LVTENRLGEV LVQRYPTVHD VRTDRALYDF TVAVKNEFMR        60
     TAQPLSRVLY DGKIHAIKNA LGTHTFVSRV QGGKLKAKHE IRIASIFREA PLEFLKMIVV       120
     HELAHLKEKE HNKAFYQLCE YMEPRYHQLE FDTRLFLTQV EIAGSPYLP                   169
//

If you have problems or comments...

PBIL Back to PBIL home page