(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE156

CP002031.PE156       Location/Qualifiers
FT   CDS             complement(164686..165993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0157"
FT                   /product="peptidoglycan L,D-transpeptidase lipoprotein,
FT                   YkuD family, SPOR domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83020"
FT                   /protein_id="ADI83020.1"
FT                   /translation="MRRIVTLPTVAYWLRSAVLGICVIALTGCAATRQAWFSPVHPESE
FT                   LERNRFQVAPGTDVIGRLGLVKLEEGDTLPDVARHFSVGINAISAANPGVDVWLPKAGQ
FT                   RITLPLNFILPDAPRKGIVINLATMRLFQFKENGGALAVSTYPVGIGTKERPTPQGPTR
FT                   VARKASRPTWYVPASIAEDHRKKGDILPARVPPGPENPLGDYALYLSRSGYLIHGTNKP
FT                   ASIGLKASNGCMRLYPEHIEVLFRDTAVNTPVLIVNQPYLIGQRDGVLYMEAHTPLEDS
FT                   GTSELARIHAKLKSFESASARTLDWDKIKQVQAEARGIPVPILELRPGAEQEAASPLRI
FT                   EHPAALYGRPELPALKLDAWYVMVGDMRDEMEARRMAAIINHQGPPIPARVLSKDSSYR
FT                   IIAGPFSDDGKARDAAKRLKIDLDIDGIVIEPGRTI"
     MRRIVTLPTV AYWLRSAVLG ICVIALTGCA ATRQAWFSPV HPESELERNR FQVAPGTDVI        60
     GRLGLVKLEE GDTLPDVARH FSVGINAISA ANPGVDVWLP KAGQRITLPL NFILPDAPRK       120
     GIVINLATMR LFQFKENGGA LAVSTYPVGI GTKERPTPQG PTRVARKASR PTWYVPASIA       180
     EDHRKKGDIL PARVPPGPEN PLGDYALYLS RSGYLIHGTN KPASIGLKAS NGCMRLYPEH       240
     IEVLFRDTAV NTPVLIVNQP YLIGQRDGVL YMEAHTPLED SGTSELARIH AKLKSFESAS       300
     ARTLDWDKIK QVQAEARGIP VPILELRPGA EQEAASPLRI EHPAALYGRP ELPALKLDAW       360
     YVMVGDMRDE MEARRMAAII NHQGPPIPAR VLSKDSSYRI IAGPFSDDGK ARDAAKRLKI       420
     DLDIDGIVIE PGRTI                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page