(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE158

CP002031.PE158       Location/Qualifiers
FT   CDS             complement(167251..168456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0160"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83023"
FT                   /protein_id="ADI83023.2"
FT                   /translation="MTSLRRNIPLLYAFSFLQMTLFPMAVITLFWKDQIGLSLSEILLL
FT                   QSIFAVAMAVMEYPSGYISDRIGYRAALTAASALGIAGWAVYTAATSFRDVLIAEILLG
FT                   IATSFISGTDSALLYESLKEQGEETAYARHEGRSTFFGQTGEAAGALFAGVLYARYPLL
FT                   PFFLQVGVWVLALFLTRRLTEPARERHHQASHLKEALASASYVFVRNRRLRATILLSIA
FT                   LGLASFYPVWLIQPYMRDSGVPLASFGPIWAGANLVVALFAVLSHRVRAGLGDRPMLLL
FT                   LVLLVWVGYLGLGWTAGAWSFLFYYLLTAMRGMRGPLLLHLVQDEIPSANRAGMLSLQS
FT                   LCFRLLFACTAPLVGRYADAAGAGGTFRLLAAAYLLVLPPLVYLFFRHLHADGSSACKG
FT                   GT"
     MTSLRRNIPL LYAFSFLQMT LFPMAVITLF WKDQIGLSLS EILLLQSIFA VAMAVMEYPS        60
     GYISDRIGYR AALTAASALG IAGWAVYTAA TSFRDVLIAE ILLGIATSFI SGTDSALLYE       120
     SLKEQGEETA YARHEGRSTF FGQTGEAAGA LFAGVLYARY PLLPFFLQVG VWVLALFLTR       180
     RLTEPARERH HQASHLKEAL ASASYVFVRN RRLRATILLS IALGLASFYP VWLIQPYMRD       240
     SGVPLASFGP IWAGANLVVA LFAVLSHRVR AGLGDRPMLL LLVLLVWVGY LGLGWTAGAW       300
     SFLFYYLLTA MRGMRGPLLL HLVQDEIPSA NRAGMLSLQS LCFRLLFACT APLVGRYADA       360
     AGAGGTFRLL AAAYLLVLPP LVYLFFRHLH ADGSSACKGG T                           401
//

If you have problems or comments...

PBIL Back to PBIL home page