(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE167

CP002031.PE167       Location/Qualifiers
FT   CDS             174422..175504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0170"
FT                   /product="ADP-ribosylglycohydrolase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83033"
FT                   /protein_id="ADI83033.1"
FT                   /translation="MSEATTIRDRAAGAVMGAFVGEALGLGPHWYYDLDEMRRDFGPWI
FT                   SDYTDPRPDRYHAGLKAGQLSQAGYILKLLLRSLVACGGYDEADFCRRLDEELLPLLDG
FT                   TPVCGPGGYTSQSIRELWRQRVELKLPWGRTGGHADTTEAAERTLALAVRYACEPARLA
FT                   AAVAGNCVLTQIDDTVVSMTTAYGAVLGMLVRGHPLDADLSARLMALVARGELPFHAVT
FT                   TGNLQPPRPGEPDPPRAGKFASPDALLTPSYMAAAAADPQVRIEPAWKVSVVYGMPCAI
FT                   YHILPAVYYLAARFRDDFEAAVLHAVNGGGQNQARAMLAGALVGAQVGLSRIPWRFIDS
FT                   LEESATLCRLADDLAAQVCA"
     MSEATTIRDR AAGAVMGAFV GEALGLGPHW YYDLDEMRRD FGPWISDYTD PRPDRYHAGL        60
     KAGQLSQAGY ILKLLLRSLV ACGGYDEADF CRRLDEELLP LLDGTPVCGP GGYTSQSIRE       120
     LWRQRVELKL PWGRTGGHAD TTEAAERTLA LAVRYACEPA RLAAAVAGNC VLTQIDDTVV       180
     SMTTAYGAVL GMLVRGHPLD ADLSARLMAL VARGELPFHA VTTGNLQPPR PGEPDPPRAG       240
     KFASPDALLT PSYMAAAAAD PQVRIEPAWK VSVVYGMPCA IYHILPAVYY LAARFRDDFE       300
     AAVLHAVNGG GQNQARAMLA GALVGAQVGL SRIPWRFIDS LEESATLCRL ADDLAAQVCA       360
//

If you have problems or comments...

PBIL Back to PBIL home page