(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE168

CP002031.PE168       Location/Qualifiers
FT   CDS             175559..175777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0171"
FT                   /product="flavin and coenzyme A sequestration protein
FT                   dodecin"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83034"
FT                   /protein_id="ADI83034.1"
FT                   /translation="MYGKDRIYKKVEIIGVSGVSIEGAIETALVRARNSLDKLSWFEVQ
FT                   EVRGHIGADGKVAEYQVVLKVSFELKD"
     MYGKDRIYKK VEIIGVSGVS IEGAIETALV RARNSLDKLS WFEVQEVRGH IGADGKVAEY        60
     QVVLKVSFEL KD                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page